Repair & Recovery

LL-37

5 mg

LL-37 is a 37-amino-acid human cathelicidin antimicrobial peptide supplied at a 5 mg fill weight in a holographic-sealed vial, characterized by reverse-phase HPLC purity and mass-spectrometry identity confirmation.

Amino acid sequence

[LL-37, 37 aa]

37 residues

Quantity

$69.99

Technical notes

Research Profile

LL-37 is the cleaved C-terminal fragment of the human cathelicidin precursor hCAP-18 and is widely used as reference material in innate-immunity, membrane-disruption, and anti-biofilm model systems.

Net peptide content, purity, and fill weight are stated on the certificate so molar concentrations can be calculated precisely for serial dilutions in microbial and cell-culture assays.

Handling & reconstitution

Add diluent slowly down the vial wall and swirl gently — do not vortex. Aliquot promptly to avoid freeze-thaw cycling.

Lab assistant

AI Dosing & Reconstitution Assistant

Enter your vial, diluent, and target aliquot in any unit — mcg, mg, g, mL, µL, or U-100 syringe units. Every value is range-checked before generation, and the assistant returns concentration, draw volume, and a reconstitution workflow tailored to LL-37.

Inputs are inside normal laboratory ranges: 2.5 mg/mL, draw 0.1 mL (10 U), ~20 aliquots per vial · aliquot = 250 mcg.

Draw volume in every unit: 0.1 mL · 100 µL · 10 U.

Target aliquot: 250 mcg · 0.25 mg · 0.0003 g.

Dosing schedule generator

Choose a cadence and a time window to lay out a day-by-day plan with per-day and cumulative totals, draw volumes, and vials required. Planning aid for laboratory record-keeping only.

1 aliquot every day

1 – 180 days

Aliquots
14

14 active / 0 rest days

Total mass (mcg)
3,500

250 mcg per aliquot

Total draw
1.4 mL

0.1 mL per aliquot

Vials required
0.7

stock 1 · 1 vial ≈ 14 days

DayDateTimesDaily (mcg)Draw (mL)Cumulative (mcg)Vials
1Aug 28, 2026 Fri08:002500.12500.05
2Aug 29, 2026 Sat08:002500.15000.1
3Aug 30, 2026 Sun08:002500.17500.15
4Aug 31, 2026 Mon08:002500.11,0000.2
5Sep 1, 2026 Tue08:002500.11,2500.25
6Sep 2, 2026 Wed08:002500.11,5000.3
7Sep 3, 2026 Thu08:002500.11,7500.35
8Sep 4, 2026 Fri08:002500.12,0000.4
9Sep 5, 2026 Sat08:002500.12,2500.45
10Sep 6, 2026 Sun08:002500.12,5000.5
11Sep 7, 2026 Mon08:002500.12,7500.55
12Sep 8, 2026 Tue08:002500.13,0000.6
13Sep 9, 2026 Wed08:002500.13,2500.65
14Sep 10, 2026 Thu08:002500.13,5000.7
Totals3,5001.43,5000.7

Planning aid · Research Use Only · not for human or veterinary administration

Protocol history

Saved protocols for this compound will appear here. Every generated dosing & reconstitution result is stored locally on this device so you can revisit or reprint an earlier version.

Saved calculations across every compound live on the calculation history page.

Literature

Research Citations

Curated entry points into the peer-reviewed record for this compound. Links open indexed searches at the U.S. National Library of Medicine so you can verify the current literature yourself rather than relying on a static citation list.

Compliance

LL-37 is supplied strictly as a laboratory reference material. It is not a drug, supplement, food, or cosmetic, and it is not for therapeutic or diagnostic use, human consumption, or veterinary use. Purchasers are responsible for handling the material in accordance with their institutional and jurisdictional requirements.

← Back to catalog

Customer reviews

Verified Feedback

Rating summary

Loading reviews…

Write a review

Your rating

All reviews are moderated before publication. Reviews describing human or veterinary use cannot be published.

    Shipping & Returns

    Delivery & Refund Policy

    Related Peptides

    Similar by category, dosage, or research focus.