Tissue Research
LL-37
5 mg
LL-37 is a 37-amino-acid human cathelicidin antimicrobial peptide supplied at a 5 mg fill weight in a holographic-sealed vial, characterized by reverse-phase HPLC purity and mass-spectrometry identity confirmation.
Amino acid sequence
[LL-37, 37 aa]
37 residues
$55.99$69.9920% Off
Technical notes
Material Profile
LL-37 is the cleaved C-terminal fragment of the human cathelicidin precursor hCAP-18 and is widely used as reference material in innate-immunity, membrane-disruption, and anti-biofilm model systems.
Net peptide content, purity, and fill weight are stated on the certificate so molar concentrations can be calculated precisely for serial dilutions in microbial and cell-culture assays.
Compliance
LL-37 is supplied strictly as a laboratory reference material. It is not a drug, supplement, food, or cosmetic, and it is not for therapeutic or diagnostic use, human consumption, or veterinary use. Purchasers are responsible for handling the material in accordance with their institutional and jurisdictional requirements.
← Back to catalogCustomer reviews
Verified Feedback
Rating summary
Loading reviews…
Write a review
Shipping & Returns
Delivery & Refund Policy
Related Peptides
Similar by category, dosage, or research focus.
