Repair & Recovery
LL-37
5 mg
LL-37 is a 37-amino-acid human cathelicidin antimicrobial peptide supplied at a 5 mg fill weight in a holographic-sealed vial, characterized by reverse-phase HPLC purity and mass-spectrometry identity confirmation.
Amino acid sequence
[LL-37, 37 aa]
37 residues
$69.99
Technical notes
Research Profile
LL-37 is the cleaved C-terminal fragment of the human cathelicidin precursor hCAP-18 and is widely used as reference material in innate-immunity, membrane-disruption, and anti-biofilm model systems.
Net peptide content, purity, and fill weight are stated on the certificate so molar concentrations can be calculated precisely for serial dilutions in microbial and cell-culture assays.
Handling & reconstitution
Add diluent slowly down the vial wall and swirl gently — do not vortex. Aliquot promptly to avoid freeze-thaw cycling.
Lab assistant
AI Dosing & Reconstitution Assistant
Enter your vial, diluent, and target aliquot in any unit — mcg, mg, g, mL, µL, or U-100 syringe units. Every value is range-checked before generation, and the assistant returns concentration, draw volume, and a reconstitution workflow tailored to LL-37.
Inputs are inside normal laboratory ranges: 2.5 mg/mL, draw 0.1 mL (10 U), ~20 aliquots per vial · aliquot = 250 mcg.
Draw volume in every unit: 0.1 mL · 100 µL · 10 U.
Target aliquot: 250 mcg · 0.25 mg · 0.0003 g.
Dosing schedule generator
Choose a cadence and a time window to lay out a day-by-day plan with per-day and cumulative totals, draw volumes, and vials required. Planning aid for laboratory record-keeping only.
1 aliquot every day
1 – 180 days
- Aliquots
- 14
- Total mass (mcg)
- 3,500
- Total draw
- 1.4 mL
- Vials required
- 0.7
14 active / 0 rest days
250 mcg per aliquot
0.1 mL per aliquot
stock 1 · 1 vial ≈ 14 days
| Day | Date | Times | Daily (mcg) | Draw (mL) | Cumulative (mcg) | Vials |
|---|---|---|---|---|---|---|
| 1 | Aug 28, 2026 Fri | 08:00 | 250 | 0.1 | 250 | 0.05 |
| 2 | Aug 29, 2026 Sat | 08:00 | 250 | 0.1 | 500 | 0.1 |
| 3 | Aug 30, 2026 Sun | 08:00 | 250 | 0.1 | 750 | 0.15 |
| 4 | Aug 31, 2026 Mon | 08:00 | 250 | 0.1 | 1,000 | 0.2 |
| 5 | Sep 1, 2026 Tue | 08:00 | 250 | 0.1 | 1,250 | 0.25 |
| 6 | Sep 2, 2026 Wed | 08:00 | 250 | 0.1 | 1,500 | 0.3 |
| 7 | Sep 3, 2026 Thu | 08:00 | 250 | 0.1 | 1,750 | 0.35 |
| 8 | Sep 4, 2026 Fri | 08:00 | 250 | 0.1 | 2,000 | 0.4 |
| 9 | Sep 5, 2026 Sat | 08:00 | 250 | 0.1 | 2,250 | 0.45 |
| 10 | Sep 6, 2026 Sun | 08:00 | 250 | 0.1 | 2,500 | 0.5 |
| 11 | Sep 7, 2026 Mon | 08:00 | 250 | 0.1 | 2,750 | 0.55 |
| 12 | Sep 8, 2026 Tue | 08:00 | 250 | 0.1 | 3,000 | 0.6 |
| 13 | Sep 9, 2026 Wed | 08:00 | 250 | 0.1 | 3,250 | 0.65 |
| 14 | Sep 10, 2026 Thu | 08:00 | 250 | 0.1 | 3,500 | 0.7 |
| Totals | 3,500 | 1.4 | 3,500 | 0.7 | ||
Planning aid · Research Use Only · not for human or veterinary administration
Protocol history
Saved protocols for this compound will appear here. Every generated dosing & reconstitution result is stored locally on this device so you can revisit or reprint an earlier version.
Saved calculations across every compound live on the calculation history page.
Literature
Research Citations
Curated entry points into the peer-reviewed record for this compound. Links open indexed searches at the U.S. National Library of Medicine so you can verify the current literature yourself rather than relying on a static citation list.
Compliance
LL-37 is supplied strictly as a laboratory reference material. It is not a drug, supplement, food, or cosmetic, and it is not for therapeutic or diagnostic use, human consumption, or veterinary use. Purchasers are responsible for handling the material in accordance with their institutional and jurisdictional requirements.
← Back to catalogCustomer reviews
Verified Feedback
Rating summary
Loading reviews…
Write a review
Shipping & Returns
Delivery & Refund Policy
Related Peptides
Similar by category, dosage, or research focus.



