GLP-3
10 mg
$129.99
Next-generation incretin-class reference peptide supplied in a holographic-sealed amber vial. Filled at 10 mg with lot-bound HPLC and mass-spectrometry documentation.
Catalog
Research Peptides
Each reference material below has its own technical page with the amino acid sequence, molecular mass, solubility and storage data, and links to the primary research literature.
Use case
Dosage
Price
60 of 60 reference materials
GLP-3
30 mg
$299.99
Higher-fill incretin-class reference peptide for extended in vitro protocols. Supplied in a holographic-sealed amber vial at 30 mg with lot-bound HPLC and mass-spectrometry documentation.
GLP-3
40 mg
$389.99
Maximum-fill incretin-class reference peptide for high-throughput or long-duration in vitro protocols. Supplied in a holographic-sealed amber vial at 40 mg with lot-bound HPLC and mass-spectrometry documentation.
Wolverine Peptide Stack
10 mg
$79.99
Dual-component research stack combining BPC-157 and TB-500 reference peptides in one holographic-sealed amber vial at a 10 mg total fill, with lot-bound HPLC and mass-spectrometry documentation.
KLOW BLEND
80 mg
$179.00
Research-grade quad-component blend of GHK-Cu, BPC-157, TB-500, and KV in one holographic-sealed amber vial at an 80 mg total fill, with lot-bound HPLC and mass-spectrometry documentation.
MOTS-C
10 mg
$69.99
MRWQEMGYIFYPRKLR
Mitochondrial-derived peptide reference material supplied in a holographic-sealed amber vial at a 10 mg fill with lot-bound HPLC and mass-spectrometry documentation.
MOTS-C
20 mg
$139.99
MRWQEMGYIFYPRKLR
Mid-fill mitochondrial-derived peptide reference material for multi-plate metabolic study designs. Holographic-sealed amber vial at 20 mg with lot-bound documentation.
MOTS-C
30 mg
$209.99
MRWQEMGYIFYPRKLR
Higher-fill mitochondrial-derived peptide reference material for extended in vitro protocols. Holographic-sealed amber vial at 30 mg with lot-bound documentation.
MOTS-C
40 mg
$299.99
MRWQEMGYIFYPRKLR
Maximum-fill mitochondrial-derived peptide reference material for high-throughput or long-duration metabolic research. Holographic-sealed amber vial at 40 mg with lot-bound documentation.
NAD+
500 mg
$99.99
Nicotinamide adenine dinucleotide, the flagship reference material in our catalog. Amber-sealed vials with lot-coded labels and full batch documentation.
NAD+
1000 mg
$199.99
High-fill nicotinamide adenine dinucleotide reference material for extended in vitro protocols, supplied in a 10 mL holographic-capped vial at a 1000 mg fill with lot-bound HPLC and mass-spectrometry documentation.
LL-37
5 mg
$69.99
[LL-37, 37 aa]
Human cathelicidin antimicrobial peptide reference material for innate-immunity, biofilm, and host-defense model systems. Holographic-sealed vial at a 5 mg fill with lot-bound documentation.
KPV
10 mg
$49.99
KPV
Alpha-MSH C-terminal tripeptide reference material for inflammatory-pathway and mucosal model research. Holographic-sealed vial at a 10 mg fill with lot-bound documentation.
BPC-157
10 mg
$79.99
GEPPPGKPADDAGLV
Pentadecapeptide reference material widely used in tissue-repair and gastrointestinal model systems. Supplied in a holographic-sealed amber vial at a 10 mg fill with lot-bound documentation.
GLOW BLEND
70 mg
$139.99
Tri-component research blend of GHK-Cu, BPC-157, and TB-500 in one holographic-sealed amber vial at a 70 mg total fill, with lot-bound HPLC and mass-spectrometry documentation.
CJC-1295 & Ipamorelin Blend
10 mg
$79.99
Dual-component secretagogue research blend pairing CJC-1295 (no DAC) with Ipamorelin in a holographic-sealed amber vial at a 10 mg total fill, with lot-bound documentation.
DSIP
5 mg
$49.99
WAGGDASGE
Delta sleep-inducing peptide reference material for sleep-architecture, neuroendocrine, and stress-response model systems. Holographic-sealed amber vial at a 5 mg fill.
TB-500
10 mg
$89.99
LKKTETQ
Thymosin beta-4 active fragment supplied in a holographic-sealed amber vial at a 10 mg fill, with lot-bound HPLC purity and mass-spectrometry identity confirmation for actin-binding and cell-migration research.
Ipamorelin
10 mg
$59.99
Aib-His-D-2-Nal-D-Phe-Lys-NH2
Selective pentapeptide growth-hormone secretagogue and GHS-R1a agonist reference material supplied in a holographic-sealed vial at a 10 mg fill, with lot-bound HPLC and mass-spectrometry documentation.
Semax
5 mg
$49.99
MEHFPGP
ACTH(4-10) analog reference peptide supplied in a holographic-sealed amber vial at a 5 mg fill, with lot-bound HPLC and mass-spectrometry documentation for neurotrophic-expression research.
Semax
10 mg
$89.99
MEHFPGP
ACTH(4-10) analog used in neurotrophic factor expression and cognition-model investigations. Holographic-sealed amber vial at a 10 mg fill with lot-bound documentation.
Selank
5 mg
$49.99
TKPRPGP
Tuftsin analog reference peptide supplied in a holographic-sealed amber vial at a 5 mg fill, with lot-bound documentation for anxiolytic-pathway and neuroimmune research.
Selank
10 mg
$89.99
TKPRPGP
Tuftsin analog reference peptide for anxiolytic-pathway and neuroimmune research. Holographic-sealed amber vial at a 10 mg fill with lot-bound documentation.
GHK-Cu
50 mg
$59.99
GHK (Cu²⁺ complex)
Copper tripeptide-1 used in collagen synthesis, wound-model, and dermal matrix research.
SS-31
10 mg
$89.99
D-Arg-Dmt-Lys-Phe-NH2
Mitochondrial-targeted tetrapeptide reference material supplied in a holographic-sealed amber vial at a 10 mg fill, with lot-bound HPLC and mass-spectrometry documentation.
Oxytocin
10 mg
$49.99
CYIQNCPLG (C-terminal amide; disulfide Cys1–Cys6)
Cyclic nonapeptide reference material for oxytocin receptor (OXTR) binding and social-behavior signaling study designs. Supplied as a lyophilized peptide with lot-coded documentation.
Melatonin 1
10 mg
$39.99
N-acetyl-5-methoxytryptamine reference material for MT1/MT2 receptor-binding and circadian-signaling research, supplied in a holographic-sealed vial with lot-bound HPLC documentation.
PT-141
5 mg
$49.99
Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH
Cyclic heptapeptide melanocortin-receptor reference material (bremelanotide) supplied at a 5 mg fill for MC3R/MC4R binding and CNS signaling research, with lot-coded HPLC and MS documentation.
Thymosin Alpha 1
10 mg
$99.99
Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH
Synthetic thymic peptide reference material for immune-modulation, TLR signaling, and T-cell differentiation research. Supplied in a holographic-sealed amber vial at a 10 mg fill with lot-bound HPLC and mass-spectrometry documentation.
Tesamorelin
10 mg
$99.99
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
Synthetic GHRH analog reference material for growth-hormone release, lipolysis, and metabolic pathway research. Supplied in a holographic-sealed amber vial at a 10 mg fill with lot-bound HPLC and mass-spectrometry documentation.
Vesilute Peptide
20 mg
$59.99
Glu-Asp (ED)
Synthetic Glu-Asp dipeptide reference material for bladder-epithelium, urinary-tract, and gene-expression research. Supplied in a holographic-sealed amber vial at a 20 mg fill with lot-bound HPLC and mass-spectrometry documentation.
Liposomal Glutathione
500 mg per 6 mL serving
$39.99
gamma-Glu-Cys-Gly (reduced glutathione)
Liposomal reduced glutathione in a sunflower-lecithin phospholipid delivery system — 500 mg glutathione plus 250 mg phospholipids per 6 mL teaspoon, 30 servings per bottle. Non-GMO, gluten-free, third-party tested, made in the USA. Dietary supplement, not a research chemical.
Liposomal Quercetin
500 mg per 6 mL serving
$23.99
Liposomal quercetin from Sophora japonica in a sunflower-lecithin phospholipid delivery system — 500 mg quercetin plus 250 mg phospholipids per 6 mL teaspoon, 30 servings per bottle. Supports immune health, healthy inflammation response, cardiovascular health, and histamine balance. Non-GMO, gluten-free, third-party tested, made in the USA. Dietary supplement, not a research chemical.
Microsomal Ashwagandha
700 mg per 1 mL serving
$23.99
Microsomal Ashwagandha with KSM-66 and CO2 extract — 600 mg full-spectrum KSM-66 root extract (standardized to 5% withanolides) plus 100 mg supercritical CO2 extract per 1 mL dropper, 59 servings per bottle. Supports stress relief, mental well-being, calm mood, and cognitive function. USDA Organic, Non-GMO Project Verified, made in the USA. Dietary supplement, not a research chemical.
Complete Liver Pro
1,890 mg per 3-capsule serving
$39.99
Complete Liver Complex (CLC) — a synergistic capsule blend built to support the liver's phase I and phase II conjugation detoxification pathways. Each 3-capsule serving delivers NAC, gamma-glutamylcysteine, calcium D-glucarate, phosphatidylcholine, glycine, artichoke leaf extract, DHM, NACET, taurine, selenium, and molybdenum. 90 capsules, 30 servings. Dietary supplement, not a research chemical.
Peak Amino
6.58 g per scoop (30 servings)
$39.99
Peak Amino — a naturally mango-flavored essential amino acid (EAA) powder delivering all 9 essential aminos per 6.58 g scoop, led by 2,000 mg L-leucine. Formulated for muscle building, athletic recovery, and hydration support. Milk free, sugar free, gluten free, non-GMO, and third-party tested. 30 servings per container. Dietary supplement, not a research chemical.
Selenium 200 mcg
200 mcg per capsule (60 capsules)
$19.99
Selenium 200 mcg — a high-potency essential trace mineral supplied as L-selenomethionine, the highly bioavailable organic form. One capsule daily supports immune system health, antioxidant defense, and normal thyroid function. 60 capsules, 60 servings. Dietary supplement, not a research chemical.
Magnesium L-Threonate
2,100 mg per 3-capsule serving
$29.99
Magnesium L-Threonate — a highly absorbable chelated magnesium delivering 2,100 mg of magnesium L-threonate (151 mg elemental magnesium) per 3-capsule serving. Formulated for targeted cognitive support, sleep quality, muscle relaxation, and everyday wellness. 90 capsules, 30 servings. Dietary supplement, not a research chemical.
Urolithin A
500 mg per capsule
$29.99
Urolithin A 500 mg — a postbiotic ellagitannin metabolite formulated for longevity and cellular energy support, including cellular renewal, energy and endurance, and healthy aging. One capsule daily, 60 servings per bottle. Vegan, non-GMO, gluten free, GMP quality, with zero fillers, binders, or artificial color. Dietary supplement, not a research chemical.
Berberinex
Advanced formula / 2 capsules
$29.99
Berberinex — an enhanced-absorption metabolic support complex with dihydroberberine, bitter melon, cinnamon, chromium, biotin, sea buckthorn, alpha-lipoic acid, banaba, gymnema, fucoxanthin, Panax ginseng, and astragalus. Two capsules daily, 30 servings. Dietary supplement, not a research chemical.
Alpha Stack
Primal Force Complex / 2 capsules
$29.99
Alpha Stack — a synergistic bio-optimization blend led by 500 mg each of Fadogia agrestis, Tongkat Ali, and Turkesterone, with 100 mg Mucuna pruriens 98% L-Dopa, Tribulus, ashwagandha, fenugreek, shilajit, pine pollen, and black pepper extract. Two capsules daily, 30 servings. Dietary supplement, not a research chemical.
TUDCA Pro
500 mg per 2-capsule serving
$39.99
TUDCA Pro — a dual-source digestive and bile-support formula delivering 250 mg tauroursodeoxycholic acid and 250 mg desiccated ox bile extract per 2-capsule serving. Naturally gluten free, non-GMO, and made with vegetable capsules. 30 servings per bottle. Dietary supplement, not a research chemical.
Zinc Carnosine
75 mg per capsule
$29.99
Zinc Carnosine — a gastrointestinal support complex combining 75 mg zinc L-carnosine (16 mg elemental zinc), 300 mg deglycyrrhizinated licorice, and 250 mg mastic gum per capsule. Vegan, non-GMO, naturally gluten free, and GMP certified. 60 servings per bottle. Dietary supplement, not a research chemical.
Reconstitution Solution
10 mL sterile solution
$12.99
Reconstitution Solution — a sterile 10 mL bacteriostatic-grade diluent formulated for reconstituting lyophilized research peptides. Supplied in a sealed multi-dose vial for laboratory reference workflows. Research use only.
Insulin Syringes
1 mL · 31G × 6 mm · 100 count
$24.99
Disposable Insulin Syringes — a box of 100 sterile, single-use 1 mL syringes with a fixed 31G × 6 mm needle and 100-unit graduations for accurate small-volume measurement in laboratory workflows. Non-bacteria, non-toxic, non-pyrogenic. Research use only.
Alcohol Prep Pads
70% isopropyl alcohol · 100 count
$9.99
Alcohol Prep Pads — a box of 100 individually wrapped sterile medium pads made with 70% isopropyl alcohol for topical antiseptic surface and skin preparation. Thick pads with excellent cleansing action, single use only, not made with natural rubber latex.
TESA + IPA
5 mg + 5 mg per vial
$99.99
TESA + IPA — a dual GHRH/GHS secretagogue blend pairing 5 mg tesamorelin (a 44-aa GHRH analog) with 5 mg ipamorelin (a pentapeptide GH secretagogue) in a single 10 mL vial. Supplied as lyophilized reference material for growth-hormone axis and receptor-binding research. Research use only.
Mag Booster
2,800 mg per 4-capsule serving
$39.99
Mag Booster — an advanced magnesium and calm-focus complex delivering 2,000 mg magnesium L-threonate, 600 mg Sucrosomial® UltraMag™, 150 mg theanine, and 50 mg apigenin per 4-capsule serving. Formulated for natural magnesium support, stress relief, and mental focus. 120 capsules, 30 servings. Dietary supplement, not a research chemical.
NutriMag
500 mg magnesium per 4-tablet serving
$59.99
NutriMag — a sustained-release magnesium formula with 8-hour absorption technology, delivering 500 mg elemental magnesium as dimagnesium malate plus methylated B6, folate, and B12 per 4-tablet serving. Formulated for muscle function and nervous system support. Non-GMO, gluten-free, vegan. 240 tablets, 60 servings. Dietary supplement, not a research chemical.
GHK-Cu
120 mcg per capsule
$69.99
Gly-His-Lys · Cu(II)
GHK-Cu — an oral copper tripeptide supplement delivering 120 mcg of GHK-Cu (glycyl-L-histidyl-L-lysine copper complex) per capsule. GHK-Cu is a naturally occurring copper peptide studied for its roles in skin, connective tissue, and cellular signaling. 90 capsules per bottle. Dietary supplement, not a research chemical.
KPV MAX
2 capsules per serving
$89.99
Lys-Pro-Val
KPV MAX — a targeted tripeptide complex combining KPV (Lys-Pro-Val) 500 mcg with palmitoylethanolamide (PEA) 500 mg, sodium bicarbonate 400 mg, and hyaluronic acid 100 mg per 2-capsule serving. KPV is a naturally occurring tripeptide studied for gut, skin, and cellular-signaling support; PEA is an endogenous fatty-acid amide researched for comfort and inflammatory balance. 60 capsules, 30 servings. Dietary supplement, not a research chemical.
5-Amino-1-MQ
50 mg per capsule
$89.99
5-Amino-1-MQ — an oral supplement delivering 50 mg of 5-amino-1-methylquinolinium per capsule. 5-Amino-1-MQ is a small-molecule NNMT (nicotinamide N-methyltransferase) inhibitor studied in the literature for its roles in cellular NAD+ metabolism and metabolic signaling. 60 capsules per bottle. Dietary supplement, not a research chemical.
TB-500 Capsules
500 mcg per capsule
$89.99
Ac-SDKP region (Thymosin Beta-4 fragment)
TB-500 Capsules — an oral supplement delivering 500 mcg of TB-500 (the active-region fragment of Thymosin Beta-4) per capsule. TB-500 is a synthetic fragment studied in the literature for its roles in actin regulation, cell migration, and tissue-repair signaling. 90 capsules per bottle. Dietary supplement, not a research chemical.
FLOW MAX
2 capsules per serving
$109.00
FLOW MAX — an advanced cognitive-flow complex combining tesofensine 250 mcg, taurine 500 mg, and magnesium L-threonate 350 mg per 2-capsule serving. Formulated for focus, drive, and mental clarity support. 60 capsules, 30 servings. Dietary supplement, not a research chemical.
SLU-PP-332
250 mcg per capsule
$69.99
SLU-PP-332 — an oral supplement delivering 250 mcg of SLU-PP-332, a synthetic pan-ERR (estrogen-related receptor) agonist, per capsule. SLU-PP-332 is studied in the literature for its roles in exercise-mimetic metabolic signaling and mitochondrial function. 90 capsules per bottle. Dietary supplement, not a research chemical.
Tesofensine
500 mcg per capsule
$79.99
Tesofensine — an oral supplement delivering 500 mcg of tesofensine per capsule. Tesofensine is a triple monoamine reuptake inhibitor studied in the literature for its roles in appetite signaling, energy balance, and neurotransmitter modulation. 90 capsules, 90 servings. Dietary supplement, not a research chemical.
BPC-157 MAX
2 capsules per serving
$99.99
BPC-157 MAX — an advanced oral complex combining BPC-157 (as arginine salt) with palmitoylethanolamide (PEA), sodium bicarbonate, and hyaluronic acid per 2-capsule serving. BPC-157 is studied in the literature for its roles in tissue-repair and gut-barrier signaling; the buffered formula is designed for oral stability. 60 capsules, 30 servings. Dietary supplement, not a research chemical.
GHK-Cu MAX
2 capsules per serving
$99.99
GHK-Cu MAX — an advanced oral complex combining GHK-Cu (copper tripeptide) 5 mg with palmitoylethanolamide (PEA), sodium bicarbonate, and hyaluronic acid per 2-capsule serving. GHK-Cu is studied in the literature for its roles in skin-remodeling, collagen synthesis, and antioxidant signaling. 60 capsules, 30 servings. Dietary supplement, not a research chemical.
BPC-157 Capsules
1 capsule per serving
$69.99
BPC-157 Capsules — a single-ingredient oral formula delivering 500 mcg of BPC-157 per capsule. BPC-157 is a pentadecapeptide studied in the literature for its roles in tissue-repair signaling and gut-barrier support. 90 capsules, 90 servings. Dietary supplement, not a research chemical.
KPV Capsules
2 capsules per serving
$79.99
Lys-Pro-Val
KPV Capsules — a single-ingredient oral formula delivering 250 mcg of the tripeptide KPV (Lys-Pro-Val) per 2-capsule serving. KPV is the C-terminal fragment of alpha-MSH, studied in the literature for gut-barrier integrity, mucosal health, and inflammatory signaling. 60 capsules, 30 servings. Dietary supplement, not a research chemical.
Research Use Only — Not for Therapeutic or Diagnostic Use